PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g03310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 153aa    MW: 17832.3 Da    PI: 6.526
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g03310genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.4e-202073356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                k+++++ eq+++Le+ Fe ++++  e++++LA++lgL+ rqV vWFqNrRa++k
  CA12g03310 20 KKRRLSVEQVKALEKNFEVENKLEPERKAKLAQELGLQPRQVAVWFQNRRARWK 73
                56689************************************************9 PP

2HD-ZIP_I/II130.75.6e-4219109191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrls eqvk+LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dy++Lk+++d+lk++ e+L+ ++e+L +e+
   CA12g03310  19 EKKRRLSVEQVKALEKNFEVENKLEPERKAKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYNVLKANFDSLKHNYESLKLDNEALIKEV 109
                  69*************************************************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-201477IPR009057Homeodomain-like
PROSITE profilePS5007117.6531575IPR001356Homeobox domain
SMARTSM003894.7E-181879IPR001356Homeobox domain
PfamPF000464.7E-172073IPR001356Homeobox domain
CDDcd000862.07E-162076No hitNo description
Gene3DG3DSA:1.10.10.606.2E-212282IPR009057Homeodomain-like
PRINTSPR000311.2E-64655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000311.2E-65571IPR000047Helix-turn-helix motif
PfamPF021837.8E-1675109IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MLEGLDEEGC VEESGHVSEK KRRLSVEQVK ALEKNFEVEN KLEPERKAKL AQELGLQPRQ  60
VAVWFQNRRA RWKTKQLERD YNVLKANFDS LKHNYESLKL DNEALIKEVP RHIVLLESRV  120
ENHLSTYQVG VRFGYTEYAV FCSEDMLLVV VQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16775RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755231e-114HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016551149.14e-71PREDICTED: homeobox-leucine zipper protein ATHB-6-like
SwissprotQ940J16e-52ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A068U0039e-65A0A068U003_COFCA; Uncharacterized protein
STRINGSolyc11g010270.1.16e-61(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-53homeobox protein 16